PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00017376-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 406aa    MW: 44154.4 Da    PI: 5.5416
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00017376-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.96.1e-1559101246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g +T +E+  +v+++   G++ W++Ia+ ++ gRt++++k++w++
  PSME_00017376-RA  59 GEFTSDEEHNIVKLHSVVGNR-WSLIAAQLP-GRTDNDVKNHWNT 101
                       78*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.64E-2138110IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-103864IPR009057Homeodomain-like
PROSITE profilePS500904.173952IPR017877Myb-like domain
PROSITE profilePS5129425.41653107IPR017930Myb domain
SMARTSM007171.0E-1257105IPR001005SANT/Myb domain
PfamPF002495.0E-1359101IPR001005SANT/Myb domain
CDDcd001672.78E-960103No hitNo description
Gene3DG3DSA:1.10.10.608.7E-1965104IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MVRALTGLLP FLGDKGFDQH NMAVPTVCCG HACFAGLQRC GKSCRLRWTN YLRPDLKHGE  60
FTSDEEHNIV KLHSVVGNRW SLIAAQLPGR TDNDVKNHWN TKLKKKLSGM GIDPVTHKPF  120
SHLMAEIAST LAPPQVAHLA EAALGCFKDE MLHLLTKKRI DWQLEKTVCN GTQPANRMWD  180
LPPSNSFCHD NRAKNKRSVD ADISKADESN IFTNQPVISS SKAWDSTQIN ADIKDLSTSG  240
GFNGPYSSFL QPPGPAYLYS STLFGGGGTS SIPSPWTVQG LCHVENLDRT SILTSPPPLK  300
ASHEQQQQGQ QGVEAGGSSI ALWKLQAVEC NDDEEGSPWS QSVCSGSTCT GGDRHGFPPP  360
QIKEEEDEEE EEAASDGGGG SVKGVDAFNS DCVLWDLSDD LMNPIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-203910740108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008219084.15e-86PREDICTED: transcription repressor MYB4
TrEMBLM5WEW77e-86M5WEW7_PRUPE; Uncharacterized protein
STRINGVIT_19s0015g01280.t012e-84(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.12e-79myb domain protein 103